CCIN Antibody - C-terminal region : Biotin

CCIN Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP53646_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: CCIN is a basic protein of the sperm head cytoskeleton. This protein contains kelch repeats and a BTB/POZ domain and is necessary for normal morphology during sperm differentiation.The protein encoded by this gene is a basic protein of the sperm head cytoskeleton. This protein contains kelch repeats and a BTB/POZ domain and is necessary for normal morphology during sperm differentiation. This gene is intronless.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCIN

Key Reference: Lecuyer,C., (2000) Biol. Reprod. 63 (6), 1801-1810

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calicin

Protein Size: 588

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53646_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53646_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 881
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×