CCIN Antibody - C-terminal region : HRP

CCIN Antibody - C-terminal region : HRP
Artikelnummer
AVIARP53646_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CCIN is a basic protein of the sperm head cytoskeleton. This protein contains kelch repeats and a BTB/POZ domain and is necessary for normal morphology during sperm differentiation.The protein encoded by this gene is a basic protein of the sperm head cytoskeleton. This protein contains kelch repeats and a BTB/POZ domain and is necessary for normal morphology during sperm differentiation. This gene is intronless.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCIN

Key Reference: Lecuyer,C., (2000) Biol. Reprod. 63 (6), 1801-1810

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calicin

Protein Size: 588

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53646_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53646_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 881
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×