CCIN Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CCIN is a basic protein of the sperm head cytoskeleton. This protein contains kelch repeats and a BTB/POZ domain and is necessary for normal morphology during sperm differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCIN

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: VAYSGIRDNFHYWASPEGSMHFMRCPPVIFGRLLRDENLHVLNEDQALSA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calicin

Protein Size: 588

Purification: Affinity Purified

• Artikelnummer: AVIARP53645_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53645_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 881
• Wirt: Rabbit
• Konjugat: Conjugated, HRP