CCNDBP1 Antibody - middle region : HRP

CCNDBP1 Antibody - middle region : HRP
Artikelnummer
AVIARP55414_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCNDBP1

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: KNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cyclin-D1-binding protein 1

Protein Size: 360

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55414_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55414_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23582
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×