CCT6B Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: CCT6B is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCT6B

Key Reference: Stirling,P.C., (2006) J. Biol. Chem. 281 (11), 7012-7021

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-complex protein 1 subunit zeta-2

Protein Size: 530

Purification: Affinity Purified

Subunit: zeta-2

• Artikelnummer: AVIARP53660_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53660_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10693
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin