Cdc42ep4 Antibody - middle region : FITC

Cdc42ep4 Antibody - middle region : FITC
Artikelnummer
AVIARP54840_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GSPKSPHRNGATGPHSPDPLLDEQAFGDLMDLPVMPKVSYGLKHAESILS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CDC42 effector protein (Rho GTPase binding) 4 (Predicted), isoform CRA_a EMBL EDM06527.1

Protein Size: 350

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54840_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54840_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 303653
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×