Cdc42ep4 Antibody - middle region : HRP

Cdc42ep4 Antibody - middle region : HRP
Artikelnummer
AVIARP54840_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GSPKSPHRNGATGPHSPDPLLDEQAFGDLMDLPVMPKVSYGLKHAESILS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: CDC42 effector protein (Rho GTPase binding) 4 (Predicted), isoform CRA_a EMBL EDM06527.1

Protein Size: 350

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54840_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54840_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 303653
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×