CDCA5 Antibody - middle region : FITC

CDCA5 Antibody - middle region : FITC
Artikelnummer
AVIARP58263_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDCA5

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sororin

Protein Size: 252

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58263_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58263_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 113130
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×