CDCA5 Antibody - middle region : HRP

CDCA5 Antibody - middle region : HRP
Artikelnummer
AVIARP58264_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDCA5

Key Reference: Schmitz,J., (2007) Curr. Biol. 17 (7), 630-636

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sororin

Protein Size: 252

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58264_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58264_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 113130
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×