CDCA7L Antibody - middle region : FITC

CDCA7L Antibody - middle region : FITC
Artikelnummer
AVIARP57292_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CDCA7L plays a role in transcriptional regulation as a repressor that inhibits monoamine oxidase A (MAOA) activity and gene expression by binding to the promoter.CDCA7L plays an important oncogenic role in mediating the full transforming effect of MYC in medulloblastoma cells. CDCA7L is involved in apoptotic signaling pathways. CDCA7L may act downstream of P38-kinase and BCL-2, but upstream of CASP3/caspase-3 as well as CCND1/cyclin D1 and E2F1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDCA7L

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: PPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKELVED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cell division cycle-associated 7-like protein

Protein Size: 420

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57292_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57292_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55536
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×