Cdk5 Antibody - middle region : Biotin

Cdk5 Antibody - middle region : Biotin
Artikelnummer
AVIARP54260_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Serine/threonine kinase is involved in synaptic regulation and neuronal development, phosphorylates synaptic protein Pctaire1 and regulates acetylcholine receptor expression.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Cdk5

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: EIVKSLLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cyclin-dependent kinase 5

Protein Size: 292

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54260_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54260_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 140908
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×