Cdk5 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Serine/threonine kinase is involved in synaptic regulation and neuronal development, phosphorylates synaptic protein Pctaire1 and regulates acetylcholine receptor expression.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Cdk5

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: EIVKSLLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cyclin-dependent kinase 5

Protein Size: 292

Purification: Affinity Purified

• Artikelnummer: AVIARP54260_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54260_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 140908
• Wirt: Rabbit
• Konjugat: Conjugated, HRP