Cdk5rap1 Antibody - C-terminal region : Biotin

Cdk5rap1 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP56907_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Cdk5rap1 is a probable regulator of CDK5 activity. It may inhibit CDK5 function via its interaction with CDK5R1.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CDK5 regulatory subunit-associated protein 1

Protein Size: 586

Purification: Affinity Purified

Subunit: -associated protein 1
Mehr Informationen
Artikelnummer AVIARP56907_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56907_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 252827
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×