CDK5RAP1 Antibody - N-terminal region : HRP

CDK5RAP1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56906_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A. The protein encoded by this gene binds to p25NCK5A and therefore may be involved in

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CDK5RAP1

Key Reference: Lehner,B. (2004) Genome Res. 14 (7), 1315-1323

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: CDK5 regulatory subunit-associated protein 1

Protein Size: 497

Purification: Affinity Purified

Subunit: -associated protein 1
Mehr Informationen
Artikelnummer AVIARP56906_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56906_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51654
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×