Cdkn3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Cdkn3 may play a role in cell cycle regulation. It has dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. It dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner.

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: LKSYGIQDVFVFCTRGELSKYRVPNLLDLYQQYGIVTHHHPIPDGGTPDI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cyclin-dependent kinase inhibitor 3

Protein Size: 211

Purification: Affinity Purified

• Artikelnummer: AVIARP53628_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53628_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 72391
• Wirt: Rabbit
• Konjugat: Conjugated, FITC