Cdkn3 Antibody - N-terminal region : HRP

Cdkn3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP53628_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Cdkn3 may play a role in cell cycle regulation. It has dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. It dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner.

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: LKSYGIQDVFVFCTRGELSKYRVPNLLDLYQQYGIVTHHHPIPDGGTPDI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cyclin-dependent kinase inhibitor 3

Protein Size: 211

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53628_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53628_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 72391
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×