CDRT4 Antibody - middle region : FITC

CDRT4 Antibody - middle region : FITC
Artikelnummer
AVIARP55668_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of CDRT4 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDRT4

Key Reference: Inoue,K., (2001) Genome Res. 11 (6), 1018-1033

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CMT1A duplicated region transcript 4 protein

Protein Size: 151

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55668_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55668_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 284040
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×