CELA2A Antibody - C-terminal region : Biotin

CELA2A Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP57697_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Like most of the human elastases, elastase 2A is secreted from the pancreas as a zymogen. In other species, elastase 2A has been shown to preferentially cleave proteins after leucine, methionine, and phenylalanine residues.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human CELA2A

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: TGWGRLQTNGAVPDVLQQGRLLVVDYATCSSSAWWGSSVKTSMICAGGDG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: chymotrypsin-like elastase family member 2A

Protein Size: 269

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57697_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57697_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 63036
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×