CENPI Antibody - N-terminal region : Biotin

CENPI Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54805_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: CENPI is involved in the response of gonadal tissues to follicle-stimulating hormone. The gene encoding CENPI is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CENPI

Key Reference: Izuta,H., (2006) Genes Cells 11 (6), 673-684

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Centromere protein I

Protein Size: 756

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54805_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54805_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Immunofluorescence, Western Blotting
Human Gene ID 2491
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×