CENPI Antibody - N-terminal region : FITC

CENPI Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54806_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CENPI

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: SKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Centromere protein I

Protein Size: 522

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54806_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54806_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2491
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×