CENPN Antibody - middle region : Biotin

CENPN Antibody - middle region : Biotin
Artikelnummer
AVIARP57258_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CENPN

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 353

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57258_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57258_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Immunofluorescence, Western Blotting
Human Gene ID 55839
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×