CENPQ Antibody - N-terminal region : HRP

CENPQ Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57121_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CENPQ is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CENPQ

Key Reference: 0

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Centromere protein Q

Protein Size: 268

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57121_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57121_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55166
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×