CEP72 Antibody - middle region : HRP

CEP72 Antibody - middle region : HRP
Artikelnummer
AVIARP57128_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene is a member of the leucine-rich-repeat (LRR) superfamily of proteins. The protein is localized to the centrosome, a non-membraneous organelle that functions as the major microtubule-organizing center in animal cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CEP72

Key Reference: N/A

Molecular Weight: 21 kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLTGLKSLDLSRNSLVSLEGIQYLTALESLNLYYNCISSLAEVFRLHAL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Centrosomal protein of 72 kDa

Protein Size: 193

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP57128_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57128_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55722
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×