CFAP299 Antibody - N-terminal region : HRP

CFAP299 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55538_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C4orf22

Key Reference: Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cilia- and flagella-associated protein 299; uncharacterized protein C4orf22

Protein Size: 233

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55538_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55538_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 255119
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×