CFAP53 Antibody - N-terminal region : Biotin

CFAP53 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55454_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene belongs to the CFAP53 family. It was found to be differentially expressed by the ciliated cells of frog epidermis and in skin fibroblasts from human. Mutations in this gene are associated with visceral heterotaxy-6, which implicates this gene in determination of left-right asymmetric patterning.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC11

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cilia- and flagella-associated protein 53

Protein Size: 514

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55454_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55454_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 220136
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×