CFAP53 Antibody - N-terminal region : HRP

CFAP53 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55454_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene belongs to the CFAP53 family. It was found to be differentially expressed by the ciliated cells of frog epidermis and in skin fibroblasts from human. Mutations in this gene are associated with visceral heterotaxy-6, which implicates this gene in determination of left-right asymmetric patterning.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC11

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cilia- and flagella-associated protein 53

Protein Size: 514

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55454_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55454_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 220136
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×