CFAP97 Antibody - middle region : FITC

CFAP97 Antibody - middle region : FITC
Artikelnummer
AVIARP57463_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1430

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: NMGYLNSSPLSRRARSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cilia- and flagella-associated protein 97

Protein Size: 532

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57463_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57463_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57587
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×