CFAP97 Antibody - middle region : HRP

CFAP97 Antibody - middle region : HRP
Artikelnummer
AVIARP57463_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1430

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: NMGYLNSSPLSRRARSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cilia- and flagella-associated protein 97

Protein Size: 532

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57463_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57463_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57587
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×