CFB Antibody - N-terminal region : Biotin

CFB Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56331_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes complement factor B, a component of the alternative pathway of complement activation. Factor B circulates in the blood as a single chain polypeptide. Upon activation of the alternative pathway, it is cleaved by complement factor D yielding the noncatalytic chain Ba and the catalytic subunit Bb. The active subunit Bb is a serine protease which associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. This cluster includes several genes involved in regulation of the immune reaction. Polymorphisms in this gene are associated with a reduced risk of age-related macular degeneration. The polyadenylation site of this gene is 421 bp from the 5' end of the gene for complement component 2.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CFAB

Key Reference: N/A

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: NGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQRRTCQEGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: complement factor B

Protein Size: 764

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP56331_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56331_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 629
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×