CFHR2 Antibody - C-terminal region : HRP

CFHR2 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54784_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CFHR2 might be involved in complement regulation. It can associate with lipoproteins and may play a role in lipid metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CFHR2

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Complement factor H-related protein 2

Protein Size: 243

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54784_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54784_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3080
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×