CFP Antibody - N-terminal region : FITC

CFP Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56381_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CFP is a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedbac

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CFP

Key Reference: Bathum,L., (2006) Mol. Immunol. 43 (5), 473-479

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Properdin

Protein Size: 469

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56381_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56381_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5199
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×