CHCHD1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHCHD1

Molecular Weight: 13

Peptide Sequence: Synthetic peptide located within the following region: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil-helix-coiled-coil-helix domain-containing protein 1

Protein Size: 118

Purification: Affinity Purified

• Artikelnummer: AVIARP53490_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53490_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 118487
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin