CHCHD3 Antibody - N-terminal region : FITC

CHCHD3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57039_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHCHD3

Key Reference: 0

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil-helix-coiled-coil-helix domain-containing protein 3, mitochondrial

Protein Size: 227

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57039_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57039_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54927
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×