CHKA Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine.The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. The protein encoded by this gene is the initial enzyme in the sequence and may play a regulatory role. The encoded protein also catalyzes the phosphorylation of ethanolamine. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHKA

Key Reference: Glunde,K., (2008) Cancer Res. 68 (1), 172-180

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Choline kinase alpha

Protein Size: 457

Purification: Affinity Purified

• Artikelnummer: AVIARP53583_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53583_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 1119
• Wirt: Rabbit
• Konjugat: Conjugated, HRP