CHODL Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a type I membrane protein with a carbohydrate recognition domain characteristic of C-type lectins in its extracellular portion. In other proteins, this domain is involved in endocytosis of glycoproteins and exogenous sugar-bearing pathogens. This protein localizes predominantly to the perinuclear region. Several transcript variants encoding a few different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CHODL

Key Reference: N/A

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: VSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Chondrolectin

Protein Size: 232

Purification: Affinity purified

• Artikelnummer: AVIARP53780_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53780_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 140578
• Wirt: Rabbit
• Konjugat: Conjugated, FITC