CHORDC1 Antibody - N-terminal region : FITC

CHORDC1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54843_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CHRD1

Key Reference: N/A

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: TYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cysteine and histidine-rich domain-containing protein 1

Protein Size: 332

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP54843_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54843_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26973
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×