CHORDC1 Antibody - N-terminal region : HRP

CHORDC1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54843_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CHRD1

Key Reference: N/A

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: TYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cysteine and histidine-rich domain-containing protein 1

Protein Size: 332

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP54843_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54843_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26973
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×