CHTF18 Antibody - middle region : FITC

CHTF18 Antibody - middle region : FITC
Artikelnummer
AVIARP57589_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CHTF18, CHTF8 (MIM 613202), and DCC1 (DSCC1; MIM 613203) are components of an alternative replication factor C (RFC) (see MIM 600404) complex that loads PCNA (MIM 176740) onto DNA during S phase of the cell cycle (Merkle et al., 2003 [PubMed 12766176]; Bermudez et al., 2003 [PubMed 12930902]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHTF18

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: QALLLDALCLLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Chromosome transmission fidelity protein 18 homolog

Protein Size: 975

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57589_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57589_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 63922
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×