CLMN Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CLMN is a single-pass type IV membrane protein. It contains 1 actin-binding domain and 2 CH (calponin-homology) domains. The exact function of CLMN remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLMN

Key Reference: Heilig,R., (2003) Nature 421 (6923), 601-607

Molecular Weight: 110kDa

Peptide Sequence: Synthetic peptide located within the following region: LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calmin

Protein Size: 1002

Purification: Affinity Purified

• Artikelnummer: AVIARP53774_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53774_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Pig (Porcine), Dog (Canine), Cow (Bovine), Yeast
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 79789
• Wirt: Rabbit
• Konjugat: Conjugated, HRP