CLPB Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CLPB

Key Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332

Molecular Weight: 78kDa

Peptide Sequence: Synthetic peptide located within the following region: ELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caseinolytic peptidase B protein homolog

Protein Size: 707

Purification: Affinity Purified

• Artikelnummer: AVIARP53791_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53791_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 81570
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin