CLUAP1 Antibody - C-terminal region : HRP

CLUAP1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP55150_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CLUAP1 may play a role in cell proliferation or apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLUAP1

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: RIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Clusterin-associated protein 1

Protein Size: 413

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55150_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55150_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23059
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×