CLUL1 Antibody - middle region : Biotin

CLUL1 Antibody - middle region : Biotin
Artikelnummer
AVIARP55044_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CLUL1

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: TEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAES

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Clusterin-like protein 1

Protein Size: 466

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55044_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55044_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27098
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×