CMPK2 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes one of the enzymes in the nucleotide synthesis salvage pathway that may participate in terminal differentiation of monocytic cells. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CMPK2

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: PSCIGQWRKIFDDEPTIIRRAFYSLGNYIVASEIAKESAKSPVIVDRYWH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UMP-CMP kinase 2, mitochondrial

Protein Size: 449

Purification: Affinity Purified

• Artikelnummer: AVIARP53517_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53517_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 129607
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin