CNDP2 Antibody - middle region : FITC

CNDP2 Antibody - middle region : FITC
Artikelnummer
AVIARP57168_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase (Teufel et al., 2003 [PubMed 12473676]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CNDP2

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: LAGRRAMKTVFGVEPDLTREGGSIPVTLTFQEATGKNVMLLPVGSADDGA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic non-specific dipeptidase

Protein Size: 475

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57168_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57168_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55748
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×