CNPY3 Antibody - N-terminal region : FITC

CNPY3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57944_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PRAT4A is associated with the immature form of TLR4 (MIM 603030) and regulates its cell surface expression (Wakabayashi et al., 2006 [PubMed 16849487]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CNPY3

Molecular Weight: 31

Peptide Sequence: Synthetic peptide located within the following region: MDSMPEPASRCLLLLPLLLLLLLLLPAPELGPSQAGAEENDWVRLPSKCE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein canopy homolog 3

Protein Size: 278

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57944_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57944_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10695
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×