COG6 Antibody - C-terminal region : FITC

COG6 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57442_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi apparatus. The encoded protein is organized with conserved oligomeric Golgi complex components 5, 7 and 8 into a sub-complex referred to as lobe B. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human COG6

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: ADMATFMVNSLYMMKTTLALFEFTDRRLEMLQFQIEAHLDTLINEQASYV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Conserved oligomeric Golgi complex subunit 6

Protein Size: 615

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57442_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57442_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57511
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×