Coil Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Coil is a mouse homolog protein localized to nuclear Cajal bodies.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Coil

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: PETQQVDIEVLSSLPALKEPGKFDLVYHNENGTEVVEYAVTQEKRITVFW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: p80 coilin EMBL AAK92459.1

Protein Size: 569

Purification: Affinity Purified

• Artikelnummer: AVIARP53622_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53622_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 50998
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin