Cops4 Antibody - N-terminal region : FITC

Cops4 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56840_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Rat homolog is a member of the COP9 complex, which may act as a regulator of cell signaling pathways.

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: VNENVSLVISRQLLTDFCTHLPNLPDSTAKEVYHFTLEKVQPRVISFEEQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: COP9 signalosome complex subunit 4

Protein Size: 406

Purification: Affinity Purified

Subunit: 4
Mehr Informationen
Artikelnummer AVIARP56840_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56840_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 360915
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×