COTL1 Antibody - N-terminal region : FITC

COTL1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55374_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COTL1

Key Reference: Dai,H., (2006) Biochim. Biophys. Acta 1764 (11), 1688-1700

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coactosin-like protein

Protein Size: 142

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55374_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55374_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23406
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×