COTL1 Antibody - N-terminal region : HRP

COTL1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55374_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COTL1

Key Reference: Dai,H., (2006) Biochim. Biophys. Acta 1764 (11), 1688-1700

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Coactosin-like protein

Protein Size: 142

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55374_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55374_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23406
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×